PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Peaxi162Scf00231g00335.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Petunioideae; Petunia
Family CPP
Protein Properties Length: 587aa    MW: 63644.9 Da    PI: 8.0843
Description CPP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Peaxi162Scf00231g00335.1genomeSGNView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCR444.5e-14128166241
                       TCR   2 ekkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNkee 41 
                               + k+CnCk+s+Clk+YCeCfa+g +C+  C+C +C+N+ e
  Peaxi162Scf00231g00335.1 128 KPKQCNCKHSRCLKLYCECFASGIYCDG-CNCANCNNNIE 166
                               5699************************.********976 PP

2TCR50.93.2e-16212251140
                       TCR   1 kekkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNke 40 
                               k++kgCnCkks ClkkYCeCf+a+  Cse+CkC +CkN e
  Peaxi162Scf00231g00335.1 212 KHNKGCNCKKSGCLKKYCECFQANILCSENCKCVECKNFE 251
                               589***********************************65 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM011141.4E-14127167IPR033467Tesmin/TSO1-like CXC domain
PROSITE profilePS5163436.378128252IPR005172CRC domain
PfamPF036384.4E-11130164IPR005172CRC domain
SMARTSM011141.0E-18212253IPR033467Tesmin/TSO1-like CXC domain
PfamPF036387.7E-13215250IPR005172CRC domain
Sequence ? help Back to Top
Protein Sequence    Length: 587 aa     Download sequence    Send to blast
MEKSEGGDFP PKKEQSEPTT SGHVSMDNST KKLARQLDFT GGSVSAPTTA AAAKPESCKP  60
IQIQQQVIRP QLQKQTQAPQ HIVMMPMQQQ LQTSLLPPHP SIRPSKPESP KARSRQSASE  120
AKDGTPKKPK QCNCKHSRCL KLYCECFASG IYCDGCNCAN CNNNIENEAA RREAIEATLM  180
RNPNAFRPKI ASSPHGAREN REEAGDGLVL AKHNKGCNCK KSGCLKKYCE CFQANILCSE  240
NCKCVECKNF EGSEERQALC HGDHGNNITH LQQAANAAIT GAVGSSGFGS PPVNKKRKAQ  300
DLFFGSMIKD PVHRLGQFQQ TDQINASAPP SSLSPTPGPR VGNAGGLGPS KFTYRSLLAD  360
LIQPQDIKEL CSVLVVYARE AAKMLADERD ASVKQAKCQS EASIPSSGVE KVMRDDCSSD  420
FQPGNIRADE STLDGADVSK DRPMSPGTLA LMCDEKDTIF TAPPPPSNDL ASLSYNTSSQ  480
PPHEQGMTEI YPELERIVLT QTRDCLKKLI TLGEIKGNQN DMNNGLAMTD SRNQHEPFSN  540
GVAKTVPPPP LKTSQMVDPA TAAANKSQFP KVHPPDYNTD VKTNNLK
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009595592.10.0PREDICTED: protein tesmin/TSO1-like CXC 5 isoform X2
SwissprotQ9SZD11e-175TCX5_ARATH; Protein tesmin/TSO1-like CXC 5
TrEMBLA0A0V0IK560.0A0A0V0IK56_SOLCH; Uncharacterized protein
STRINGSolyc07g020710.2.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA24012455
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G29000.11e-153Tesmin/TSO1-like CXC domain-containing protein